Recombinant Human CRYBB1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CRYBB1-4818H |
Product Overview : | CRYBB1 MS Standard C13 and N15-labeled recombinant protein (NP_001878) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group, none in the acidic group). Beta-crystallins form aggregates of different sizes and are able to self-associate to form dimers or to form heterodimers with other beta-crystallins. This gene, a beta basic group member, undergoes extensive cleavage at its N-terminal extension during lens maturation. It is also a member of a gene cluster with beta-A4, beta-B2, and beta-B3. |
Molecular Mass : | 28 kDa |
AA Sequence : | MSQAAKASASATVAVNPGPDTKGKGAPPAGTSPSPGTTLAPTTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQWHLEGSFPVLATEPPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CRYBB1 crystallin beta B1 [ Homo sapiens (human) ] |
Official Symbol | CRYBB1 |
Synonyms | CRYBB1; crystallin, beta B1; beta-crystallin B1; beta-B1 crystallin; eye lens structural protein; CATCN3; |
Gene ID | 1414 |
mRNA Refseq | NM_001887 |
Protein Refseq | NP_001878 |
MIM | 600929 |
UniProt ID | P53674 |
◆ Recombinant Proteins | ||
CRYBB1-1997M | Recombinant Mouse CRYBB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYBB1-1271R | Recombinant Rat CRYBB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYBB1-5754C | Recombinant Chicken CRYBB1 | +Inquiry |
CRYBB1-2495H | Recombinant Human Crystallin, Beta B1, His-tagged | +Inquiry |
CRYBB1-3938M | Recombinant Mouse CRYBB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYBB1-7262HCL | Recombinant Human CRYBB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRYBB1 Products
Required fields are marked with *
My Review for All CRYBB1 Products
Required fields are marked with *
0
Inquiry Basket