Recombinant Human CRYAB protein(21-170 aa), C-His-tagged

Cat.No. : CRYAB-2524H
Product Overview : Recombinant Human CRYAB protein(P02511)(21-170 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 21-170 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT
Gene Name CRYAB crystallin, alpha B [ Homo sapiens ]
Official Symbol CRYAB
Synonyms CRYAB; crystallin, alpha B; CRYA2; alpha-crystallin B chain; HSPB5; heat shock protein beta-5; rosenthal fiber component; heat-shock 20 kD like-protein; renal carcinoma antigen NY-REN-27; CTPP2;
Gene ID 1410
mRNA Refseq NM_001885
Protein Refseq NP_001876
MIM 123590
UniProt ID P02511

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CRYAB Products

Required fields are marked with *

My Review for All CRYAB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon