Recombinant Human CRY2

• Cat.No.: CRY2-26941TH
• Product Overview: Recombinant fragment of Human CRY2 with an N terminal proprietary tag; Predicted MW 35.64kDa.

Specification

• Protein length: 91 amino acids
• Molecular Weight: 35.640kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in all tissues examined including fetal brain, fibroblasts, heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Highest levels in heart and skele
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQG
• Sequence Similarities: Belongs to the DNA photolyase class-1 family.Contains 1 DNA photolyase domain.
• Tag: Non

Gene Information

• Gene Name: CRY2 cryptochrome 2 (photolyase-like) [ Homo sapiens ]
• Official Symbol: CRY2
• Synonyms: CRY2; cryptochrome 2 (photolyase-like); cryptochrome-2
• Gene ID: 1408
• mRNA Refseq: NM_021117
• Protein Refseq: NP_066940
• MIM: 603732
• Uniprot ID: Q49AN0
• Chromosome Location: 11p11.2
• Pathway: BMAL1:CLOCK/NPAS2 Activates Gene Expression, organism-specific biosystem; Circadian Clock, organism-specific biosystem; Circadian rhythm - mammal, organism-specific biosystem; Circadian rhythm - mammal, conserved biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem
• Function: NOT DNA (6-4) photolyase activity; DNA binding; blue light photoreceptor activity; damaged DNA binding; NOT deoxyribodipyrimidine photo-lyase activity