Recombinant Human CRY1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CRY1-2082H |
Product Overview : | CRY1 MS Standard C13 and N15-labeled recombinant protein (NP_004066) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness. |
Molecular Mass : | 66.4 kDa |
AA Sequence : | MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CRY1 cryptochrome circadian regulator 1 [ Homo sapiens (human) ] |
Official Symbol | CRY1 |
Synonyms | CRY1; cryptochrome 1 (photolyase-like); PHLL1; cryptochrome-1; photolyase-like cryptochrome 1; |
Gene ID | 1407 |
mRNA Refseq | NM_004075 |
Protein Refseq | NP_004066 |
MIM | 601933 |
UniProt ID | Q16526 |
◆ Recombinant Proteins | ||
CRY1-2125HF | Recombinant Full Length Human CRY1 Protein, GST-tagged | +Inquiry |
CRY1-3931M | Recombinant Mouse CRY1 Protein | +Inquiry |
CRY1-1608R | Recombinant Rat CRY1 Protein | +Inquiry |
CRY1-1036R | Recombinant Rhesus monkey CRY1 Protein, His-tagged | +Inquiry |
CRY1-5818C | Recombinant Chicken CRY1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRY1-7269HCL | Recombinant Human CRY1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRY1 Products
Required fields are marked with *
My Review for All CRY1 Products
Required fields are marked with *
0
Inquiry Basket