Recombinant Full Length Human CRY1 Protein, GST-tagged
Cat.No. : | CRY1-2125HF |
Product Overview : | Human CRY1 full-length ORF ( AAH30519, 1 a.a. - 586 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 586 amino acids |
Description : | This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness. [provided by RefSeq, Jan 2014] |
Molecular Mass : | 90.20 kDa |
AA Sequence : | MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRY1 cryptochrome 1 (photolyase-like) [ Homo sapiens ] |
Official Symbol | CRY1 |
Synonyms | CRY1; cryptochrome 1 (photolyase-like); PHLL1; cryptochrome-1; photolyase-like cryptochrome 1 |
Gene ID | 1407 |
mRNA Refseq | NM_004075 |
Protein Refseq | NP_004066 |
MIM | 601933 |
UniProt ID | Q16526 |
◆ Recombinant Proteins | ||
Cry1-2323M | Recombinant Mouse Cry1 Protein, Myc/DDK-tagged | +Inquiry |
CRY1-1922H | Recombinant Human CRY1 Protein, GST-tagged | +Inquiry |
CRY1-1608R | Recombinant Rat CRY1 Protein | +Inquiry |
CRY1-3931M | Recombinant Mouse CRY1 Protein | +Inquiry |
CRY1-4422H | Recombinant Human CRY1 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRY1-7269HCL | Recombinant Human CRY1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRY1 Products
Required fields are marked with *
My Review for All CRY1 Products
Required fields are marked with *
0
Inquiry Basket