Recombinant Human CRY1 protein, His&Myc-tagged
Cat.No. : | CRY1-4422H |
Product Overview : | Recombinant Human CRY1 protein(Q16526)(1-586aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
ProteinLength : | 1-586aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 73.8 kDa |
AA Sequence : | MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CRY1 cryptochrome 1 (photolyase-like) [ Homo sapiens ] |
Official Symbol | CRY1 |
Synonyms | CRY1; cryptochrome 1 (photolyase-like); PHLL1; cryptochrome-1; photolyase-like cryptochrome 1; |
Gene ID | 1407 |
mRNA Refseq | NM_004075 |
Protein Refseq | NP_004066 |
MIM | 601933 |
UniProt ID | Q16526 |
◆ Recombinant Proteins | ||
BTF3-10317H | Recombinant Human BTF3, GST-tagged | +Inquiry |
YDCG-3894B | Recombinant Bacillus subtilis YDCG protein, His-tagged | +Inquiry |
IGFBP7-533H | Recombinant Human IGFBP7 protein, His-tagged | +Inquiry |
SCO4426-422S | Recombinant Streptomyces coelicolor A3(2) SCO4426 protein, His-tagged | +Inquiry |
IFNA1-01P | Recombinant Porcine IFNA1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
CA2-34R | Native Rabbit Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Lectin-1739H | Active Native Hippeastrum Hybrid (Amaryllis) Lectin Protein | +Inquiry |
CA-50-381H | Active Native Human Cancer Antigen 50 | +Inquiry |
PLD-16C | Active Native cabbage Phospholipase D, Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
IPMK-866HCL | Recombinant Human IPMK cell lysate | +Inquiry |
CBLN2-7811HCL | Recombinant Human CBLN2 293 Cell Lysate | +Inquiry |
CACNG3-270HCL | Recombinant Human CACNG3 cell lysate | +Inquiry |
CD180-2225MCL | Recombinant Mouse CD180 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRY1 Products
Required fields are marked with *
My Review for All CRY1 Products
Required fields are marked with *
0
Inquiry Basket