Recombinant Human CRX

• Cat.No.: CRX-26343TH
• Product Overview: Recombinant fragment of Human CORD2 with a N terminal proprietary tag; Predicted MWt 36.08 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 95 amino acids
• Description: The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.
• Molecular Weight: 36.080kDa inclusive of tags
• Tissue specificity: Retina.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR
• Sequence Similarities: Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: CRX cone-rod homeobox [ Homo sapiens ]
• Official Symbol: CRX
• Synonyms: CRX; cone-rod homeobox; CORD2; cone-rod homeobox protein; CRD; LCA7; orthodenticle homeobox 3; OTX3
• Gene ID: 1406
• mRNA Refseq: NM_000554
• Protein Refseq: NP_000545
• MIM: 602225
• Uniprot ID: O43186
• Chromosome Location: 19q13.3
• Function: chromatin binding; leucine zipper domain binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity