Recombinant Human CRTC2 protein, His-tagged

• Cat.No.: CRTC2-11593H
• Product Overview: Recombinant Human CRTC2 protein is produced by E. coli-derived, PET28a expression system. This protein is fused with a His tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 394-693 aa
• Form: The purified protein was Lyophilized from sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH7.0). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: APALSSSSSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ
• Purity: > 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Samples are stable for up to twelve months from date of receipt at -70 centigrade.
• Storage: Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.

Gene Information

• Gene Name: CRTC2 CREB regulated transcription coactivator 2 [ Homo sapiens ]
• Official Symbol: CRTC2
• Synonyms: CRTC2; CREB regulated transcription coactivator 2; TORC2; TORC-2
• Gene ID: 200186
• mRNA Refseq: NM_181715
• Protein Refseq: NP_859066
• MIM: 608972
• UniProt ID: Q53ET0