Recombinant Human CRCP protein, GST-tagged

Cat.No. : CRCP-301571H
Product Overview : Recombinant Human CRCP (1-115 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Ala115
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name CRCP CGRP receptor component [ Homo sapiens ]
Official Symbol CRCP
Synonyms CRCP; CGRP receptor component; DNA-directed RNA polymerase III subunit RPC9; calcitonin gene related peptide receptor component protein; CGRP RCP; RCP; RCP9; RNA polymerase III subunit C9; CGRP-receptor component protein; calcitonin gene-related peptide-receptor component protein; CGRPRCP; CGRP-RCP; MGC111194;
Gene ID 27297
mRNA Refseq NM_001040647
Protein Refseq NP_001035737
MIM 606121
UniProt ID O75575

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CRCP Products

Required fields are marked with *

My Review for All CRCP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon