Recombinant Human CRCP Protein, His-tagged

• Cat.No.: CRCP-1838H
• Product Overview: Human CRCP (NP_055293, 1 a.a. - 148 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.

Specification

• Description: This gene encodes a membrane protein that functions as part of a receptor complex for a small neuropeptide that increases intracellular cAMP levels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
• Source: E. coli
• Species: Human
• Tag: His
• Form: Liquid
• Molecular Mass: 19.0 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL
• Storage Buffer: In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (20% glycerol, 1 mM dithiothreitol)

Gene Information

• Gene Name: CRCP CGRP receptor component [ Homo sapiens ]
• Official Symbol: CRCP
• Synonyms: CRCP; CGRP receptor component; DNA-directed RNA polymerase III subunit RPC9; calcitonin gene related peptide receptor component protein; CGRP RCP; RCP; RCP9; RNA polymerase III subunit C9; CGRP-receptor component protein; calcitonin gene-related peptide-receptor component protein; CGRPRCP; CGRP-RCP; MGC111194
• Gene ID: 27297
• mRNA Refseq: NM_001040647
• Protein Refseq: NP_001035737
• MIM: 606121
• UniProt ID: O75575