Recombinant Human CR2, StrepII-tagged

Cat.No. : CR2-237H
Product Overview : Purified human recombinant CD21 (CR2) or Complement receptor type 2 protein (amino acids 596-971, 376 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 41.6 kDa. (Accession NP_001006659.1; UniProt P20023)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 596-971, 376 a.a.
Description : This product is the intracellular domain of CD21. CD21 is the receptor for complement C3Dd, for the Epstein-Barr virus on human B-cells and T-cells, and for HNRPU. Participates in B lymphocytes activation.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
AA Sequence : SLLAVQCSHVHIANGYKISGKEAPYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKETCQHVRQSLQ ELPAGSRVELVNTSCQDGYQLTGHAYQMCQDAENGIWFKKIPLCKVIHCHPPPVIVNGKHTGMMAENFLYGNEVS YECDQGFYLLGEKKLQCRSDSKGHGSWSGPSPQCLRSPPVTRCPNPEVKHGYKLNKTHSAYSHNDIVYVDCNPGF IMNGSRVIRCHTDNTWVPGVPTCIKKAFIGCPPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCT HEGTWSQPAPHCKEVNCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSPQSQCQSDHQWNPPLAVCRS R
Endotoxin : <0.1 eu per ug protein by lal
Purity : >95% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name CR2 complement component (3d/Epstein Barr virus) receptor 2 [ Homo sapiens ]
Official Symbol CR2
Synonyms CR2; complement component (3d/Epstein Barr virus) receptor 2; complement receptor type 2; CD21; EBV receptor; complement C3d receptor; epstein-Barr virus receptor; CR; C3DR; SLEB9;
Gene ID 1380
mRNA Refseq NM_001006658
Protein Refseq NP_001006659
MIM 120650
UniProt ID P20023
Chromosome Location 1q32
Pathway B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem;
Function complement receptor activity; protein homodimerization activity; receptor activity; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CR2 Products

Required fields are marked with *

My Review for All CR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon