Recombinant Human CR2, StrepII-tagged

• Cat.No.: CR2-283H
• Product Overview: Purified human recombinant CD21 (CR2) protein (amino acids 21-347, 327 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 35.3 kDa. (Accession NP_001006659.1; UniProt P20023)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 21-347, 327 a.a.
• Description: This product is the transmembrane domain of CD21. CD21 is the receptor for complement C3Dd, for the Epstein-Barr virus on human B-cells and T-cells, and for HNRPU. Participates in B lymphocytes activation.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
• AA Sequence: ISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPI VPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLECPALPMIHNGHHTSENV GSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANFFCDEG YRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPPPILNGRHIGNSLANVSYGSIVTYTCDPDPEEGVNFILIGE STLRCTVDSQKTGTWSGPAPRCELSTS
• Endotoxin: <0.1 eu per μg protein by lal
• Purity: ~90% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml

Gene Information

• Gene Name: CR2 complement component (3d/Epstein Barr virus) receptor 2 [ Homo sapiens ]
• Official Symbol: CR2
• Synonyms: CR2; complement component (3d/Epstein Barr virus) receptor 2; complement receptor type 2; CD21; EBV receptor; complement C3d receptor; epstein-Barr virus receptor; CR; C3DR; SLEB9
• Gene ID: 1380
• mRNA Refseq: NM_001006658
• Protein Refseq: NP_001006659
• MIM: 120650
• UniProt ID: P20023
• Chromosome Location: 1q32
• Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem
• Function: complement receptor activity; protein homodimerization activity; receptor activity; transmembrane signaling receptor activity