Recombinant Human COX6C Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: COX6C-5309H
• Product Overview: COX6C MS Standard C13 and N15-labeled recombinant protein (NP_004365) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 8.8 kDa
• AA Sequence: MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: COX6C cytochrome c oxidase subunit VIc [ Homo sapiens (human) ]
• Official Symbol: COX6C
• Synonyms: COX6C; cytochrome c oxidase subunit VIc; cytochrome c oxidase subunit 6C; cytochrome c oxidase polypeptide VIc; cytochrome c oxidase subunit VIc preprotein
• Gene ID: 1345
• mRNA Refseq: NM_004374
• Protein Refseq: NP_004365
• MIM: 124090
• UniProt ID: P09669