Recombinant Human COX6C Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : COX6C-5309H
Product Overview : COX6C MS Standard C13 and N15-labeled recombinant protein (NP_004365) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12.
Molecular Mass : 8.8 kDa
AA Sequence : MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name COX6C cytochrome c oxidase subunit VIc [ Homo sapiens (human) ]
Official Symbol COX6C
Synonyms COX6C; cytochrome c oxidase subunit VIc; cytochrome c oxidase subunit 6C; cytochrome c oxidase polypeptide VIc; cytochrome c oxidase subunit VIc preprotein;
Gene ID 1345
mRNA Refseq NM_004374
Protein Refseq NP_004365
MIM 124090
UniProt ID P09669

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COX6C Products

Required fields are marked with *

My Review for All COX6C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon