Recombinant Human COX6B2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: COX6B2-695H
• Product Overview: COX6B2 MS Standard C13 and N15-labeled recombinant protein (NP_653214) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Connects the two COX monomers into the physiological dimeric form.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 10.5 kDa
• AA Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: COX6B2 cytochrome c oxidase subunit 6B2 [ Homo sapiens (human) ]
• Official Symbol: COX6B2
• Synonyms: COX6B2; cytochrome c oxidase subunit VIb polypeptide 2 (testis); cytochrome c oxidase subunit 6B2; cancer/testis antigen 59; COXVIB2; CT59; cytochrome c oxidase subunit VIb; testes specific; FLJ32865; COX VIb-2; cytochrome c oxidase subunit VIb, testes specific; cytochrome c oxidase subunit VIb, testes-specific; cytochrome c oxidase subunit VIb, testis-specific isoform; FLJ46422; MGC119094
• Gene ID: 125965
• mRNA Refseq: NM_144613
• Protein Refseq: NP_653214
• MIM: 618127
• UniProt ID: Q6YFQ2