Recombinant Human COX17 Protein, GST-tagged

• Cat.No.: COX17-1738H
• Product Overview: Human COX17 full-length ORF ( NP_005685.1, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be involved in the recruitment of copper to mitochondria for incorporation into the COX apoenzyme. This protein shares 92% amino acid sequence identity with mouse and rat Cox17 proteins. This gene is no longer considered to be a candidate gene for COX deficiency. A pseudogene COX17P has been found on chromosome 13. [provided by RefSeq, Jul 2008]
• Molecular Mass: 33.3 kDa
• AA Sequence: MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COX17 COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: COX17
• Synonyms: COX17; COX17 cytochrome c oxidase assembly homolog (S. cerevisiae); COX17 (yeast) homolog, cytochrome c oxidase assembly protein , COX17 homolog, cytochrome c oxidase assembly protein (S. cerevisiae) , COX17 homolog, cytochrome c oxidase assembly protein (yeast); cytochrome c oxidase copper chaperone; human homolog of yeast mitochondrial copper recruitment; MGC104397; MGC117386
• Gene ID: 10063
• mRNA Refseq: NM_005694
• Protein Refseq: NP_005685
• MIM: 604813
• UniProt ID: Q14061