Recombinant Human CORT Protein, GST-tagged
Cat.No. : | CORT-1729H |
Product Overview : | Human CORT full-length ORF ( NP_001293.2, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a neuropeptide that is structurally similar to somatostatin. It binds to all known somatostatin receptors, and shares many pharmacological and functional properties with somatostatin, including the depression of neuronal activity. However, it also has many properties distinct from somatostatin, such as induction of slow-wave sleep, apparently by antagonism of the excitatory effects of acetylcholine on the cortex, reduction of locomotor activity, and activation of cation selective currents not responsive to somatostatin. The preproprotein undergoes further processing into multiple mature products. Read-through transcripts exist between this gene and the upstream APITD1 (apoptosis-inducing, TAF9-like domain 1) gene, as represented in GeneID:100526739. [provided by RefSeq, Nov 2010] |
Molecular Mass : | 43.6 kDa |
AA Sequence : | MYRHKNSWRLGLKYPPSSKEETQVPKTLISGLPGRKSSSRVGEKLQSAHKMPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CORT cortistatin [ Homo sapiens (human) ] |
Official Symbol | CORT |
Synonyms | CORT; cortistatin; Cortistatin; Prepro-Cortistatin; Preprocortistatin; Cortistatin-14; Cortistatin-17; Cortistatin-29; CST-14; CST-17; CST-29; cortistatin; cortistatin-14; cortistatin-17; cortistatin-29; prepro-cortistatin; preprocortistatin |
Gene ID | 1325 |
mRNA Refseq | NM_001302 |
Protein Refseq | NP_001293 |
MIM | 602784 |
UniProt ID | O00230 |
◆ Recombinant Proteins | ||
Cort-638M | Recombinant Mouse Cort Protein, His-tagged | +Inquiry |
CORT-1907M | Recombinant Mouse CORT Protein, His (Fc)-Avi-tagged | +Inquiry |
CORT-845H | Recombinant Human CORT Protein, His-tagged | +Inquiry |
CORT-1205R | Recombinant Rat CORT Protein, His (Fc)-Avi-tagged | +Inquiry |
CORT-1729H | Recombinant Human CORT Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CORT-7339HCL | Recombinant Human CORT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CORT Products
Required fields are marked with *
My Review for All CORT Products
Required fields are marked with *
0
Inquiry Basket