Recombinant Human COPS8, His-tagged

• Cat.No.: COPS8-26339TH
• Product Overview: Recombinant full length Human COPS8 with an N terminal His tag ; mwt: 25.3 kDa.

Specification

• Description: The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Protein length: 209 amino acids
• Conjugation: HIS
• Molecular Weight: 25.300kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:10% Glycerol, 2.4% Urea, 0.32% Tris HCl
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
• Sequence Similarities: Belongs to the CSN8 family.Contains 1 PCI domain.

Gene Information

• Gene Name: COPS8 COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) [ Homo sapiens ]
• Official Symbol: COPS8
• Synonyms: COPS8; COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis); COP9 signalosome complex subunit 8; COP9; CSN8; MGC1297; SGN8
• Gene ID: 10920
• mRNA Refseq: NM_006710
• Protein Refseq: NP_006701
• Uniprot ID: Q99627
• Chromosome Location: 2q37.3