Description :	The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. [provided by RefSeq, Jul 2008]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	62.48 kDa
AA Sequence :	MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	COPS5 COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) [ Homo sapiens ]
Official Symbol	COPS5
Synonyms	COPS5; COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis); COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 5; COP9 signalosome complex subunit 5; CSN5; JAB1; MOV 34; SGN5; 38 kDa Mov34 homolog; signalosome subunit 5; jun activation domain-binding protein 1; MOV-34; MGC3149;
Gene ID	10987
mRNA Refseq	NM_006837
Protein Refseq	NP_006828
MIM	604850
UniProt ID	Q92905