Recombinant Full Length Human COPS5 Protein, C-Flag-tagged
Cat.No. : | COPS5-1043HFL |
Product Overview : | Recombinant Full Length Human COPS5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.4 kDa |
AA Sequence : | MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHAR SGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSH PGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNK IEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQL GRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINISTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease, Transcription Factors |
Full Length : | Full L. |
Gene Name | COPS5 COP9 signalosome subunit 5 [ Homo sapiens (human) ] |
Official Symbol | COPS5 |
Synonyms | CSN5; JAB1; SGN5; MOV-34 |
Gene ID | 10987 |
mRNA Refseq | NM_006837.3 |
Protein Refseq | NP_006828.2 |
MIM | 604850 |
UniProt ID | Q92905 |
◆ Recombinant Proteins | ||
COPS5-1959HF | Recombinant Full Length Human COPS5 Protein, GST-tagged | +Inquiry |
COPS5-1889M | Recombinant Mouse COPS5 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPS5-3370C | Recombinant Chicken COPS5 | +Inquiry |
COPS5-29878TH | Recombinant Human COPS5, His-tagged | +Inquiry |
COPS5-0865H | Recombinant Human COPS5 Protein (A2-T257), GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPS5-7356HCL | Recombinant Human COPS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COPS5 Products
Required fields are marked with *
My Review for All COPS5 Products
Required fields are marked with *
0
Inquiry Basket