Recombinant Human COPE protein, His-tagged
Cat.No. : | COPE-3920H |
Product Overview : | Recombinant Human COPE protein(1-308 aa), fused to His tag, was expressed in E. coli. |
Availability | March 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-308 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | COPE coatomer protein complex, subunit epsilon [ Homo sapiens ] |
Official Symbol | COPE |
Synonyms | COPE; coatomer protein complex, subunit epsilon; coatomer subunit epsilon; epsilon COP; epsilon coat protein; epsilon-coat protein; coatomer epsilon subunit; epsilon-COP; FLJ13241; |
Gene ID | 11316 |
mRNA Refseq | NM_007263 |
Protein Refseq | NP_009194 |
MIM | 606942 |
UniProt ID | O14579 |
◆ Recombinant Proteins | ||
COPE-3776M | Recombinant Mouse COPE Protein | +Inquiry |
COPE-970R | Recombinant Rhesus monkey COPE Protein, His-tagged | +Inquiry |
COPE-3920H | Recombinant Human COPE protein, His-tagged | +Inquiry |
COPE-1884M | Recombinant Mouse COPE Protein, His (Fc)-Avi-tagged | +Inquiry |
COPE-3597H | Recombinant Human COPE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPE-7361HCL | Recombinant Human COPE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COPE Products
Required fields are marked with *
My Review for All COPE Products
Required fields are marked with *
0
Inquiry Basket