Recombinant Human COL8A1 protein, His-tagged

Cat.No. : COL8A1-5633H
Product Overview : Recombinant Human COL8A1 protein(P27658)(572-744aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 572-744aa
Tag : C-His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 20.0 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : AVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM
Gene Name COL8A1 collagen, type VIII, alpha 1 [ Homo sapiens ]
Official Symbol COL8A1
Synonyms COL8A1; collagen, type VIII, alpha 1; C3orf7, chromosome 3 open reading frame 7; collagen alpha-1(VIII) chain; MGC9568; endothelial collagen; collagen VIII, alpha-1 polypeptide; cell proliferation-inducing protein 41; smooth muscle cell-expressed and macrophage conditioned medium-induced protein smag-64; C3orf7;
Gene ID 1295
mRNA Refseq NM_001850
Protein Refseq NP_001841
MIM 120251
UniProt ID P27658

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COL8A1 Products

Required fields are marked with *

My Review for All COL8A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon