Recombinant Human COL8A1 protein, His-SUMO-tagged
Cat.No. : | COL8A1-4534H |
Product Overview : | Recombinant Human COL8A1 protein(P27658)(572-744aa), fused with N-terminal His tag and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 572-744aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM |
Gene Name | COL8A1 collagen, type VIII, alpha 1 [ Homo sapiens ] |
Official Symbol | COL8A1 |
Synonyms | COL8A1; collagen, type VIII, alpha 1; C3orf7, chromosome 3 open reading frame 7; collagen alpha-1(VIII) chain; MGC9568; endothelial collagen; collagen VIII, alpha-1 polypeptide; cell proliferation-inducing protein 41; smooth muscle cell-expressed and macrophage conditioned medium-induced protein smag-64; C3orf7; |
Gene ID | 1295 |
mRNA Refseq | NM_001850 |
Protein Refseq | NP_001841 |
MIM | 120251 |
UniProt ID | P27658 |
◆ Recombinant Proteins | ||
COL8A1-1770H | Recombinant Human COL8A1 Protein (Gly28-Met744), C-His tagged | +Inquiry |
COL8A1-11440H | Recombinant Human COL8A1, His-tagged | +Inquiry |
COL8A1-5533C | Recombinant Chicken COL8A1 | +Inquiry |
COL8A1-3752M | Recombinant Mouse COL8A1 Protein | +Inquiry |
COL8A1-140H | Recombinant Human COL8A1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COL8A1-7376HCL | Recombinant Human COL8A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL8A1 Products
Required fields are marked with *
My Review for All COL8A1 Products
Required fields are marked with *
0
Inquiry Basket