Recombinant Human COL8A1 protein, His-SUMO-tagged

• Cat.No.: COL8A1-4534H
• Product Overview: Recombinant Human COL8A1 protein(P27658)(572-744aa), fused with N-terminal His tag and SUMO tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: N-His-SUMO
• ProteinLength: 572-744aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.9 kDa
• AASequence: AVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: COL8A1 collagen, type VIII, alpha 1 [ Homo sapiens ]
• Official Symbol: COL8A1
• Synonyms: COL8A1; collagen, type VIII, alpha 1; C3orf7, chromosome 3 open reading frame 7; collagen alpha-1(VIII) chain; MGC9568; endothelial collagen; collagen VIII, alpha-1 polypeptide; cell proliferation-inducing protein 41; smooth muscle cell-expressed and macrophage conditioned medium-induced protein smag-64; C3orf7
• Gene ID: 1295
• mRNA Refseq: NM_001850
• Protein Refseq: NP_001841
• MIM: 120251
• UniProt ID: P27658