Recombinant Human COL21A1 Protein, GST-tagged
Cat.No. : | COL21A1-1640H |
Product Overview : | Human COL21A1 partial ORF ( NP_110447, 221 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the alpha chain of type XXI collagen, a member of the FACIT (fibril-associated collagens with interrupted helices) collagen family. Type XXI collagen is localized to tissues containing type I collagen and maintains the integrity of the extracellular matrix. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | IPVAARDERGFDILLGLDVNKKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPSYVFVSTQRFKVKKIWDLWRILTIDGRPQIAVTLNGVDKIL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COL21A1 collagen, type XXI, alpha 1 [ Homo sapiens ] |
Official Symbol | COL21A1 |
Synonyms | COL21A1; collagen, type XXI, alpha 1; collagen alpha-1(XXI) chain; alpha 1 type XXI collagen; alpha 1 chain-like collagen; FP633; COLA1L; dJ708F5.1; dJ682J15.1; FLJ39125; FLJ44623; MGC26619; DKFZp564B052; |
Gene ID | 81578 |
mRNA Refseq | NM_030820 |
Protein Refseq | NP_110447 |
MIM | 610002 |
UniProt ID | Q96P44 |
◆ Recombinant Proteins | ||
COL21A1-1640H | Recombinant Human COL21A1 Protein, GST-tagged | +Inquiry |
COL21A1-1527HFL | Recombinant Full Length Human COL21A1 Protein, C-Flag-tagged | +Inquiry |
COL21A1-75H | Recombinant Human COL21A1 protein, MYC/DDK-tagged | +Inquiry |
COL21A1-72H | Recombinant Human COL21A1 protein, His-tagged | +Inquiry |
COL21A1-3498H | Recombinant Human COL21A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
COL21A1-380HCL | Recombinant Human COL21A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL21A1 Products
Required fields are marked with *
My Review for All COL21A1 Products
Required fields are marked with *
0
Inquiry Basket