Recombinant Human COL21A1 Protein, GST-tagged

• Cat.No.: COL21A1-1640H
• Product Overview: Human COL21A1 partial ORF ( NP_110447, 221 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes the alpha chain of type XXI collagen, a member of the FACIT (fibril-associated collagens with interrupted helices) collagen family. Type XXI collagen is localized to tissues containing type I collagen and maintains the integrity of the extracellular matrix. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
• Molecular Mass: 36.74 kDa
• AA Sequence: IPVAARDERGFDILLGLDVNKKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPSYVFVSTQRFKVKKIWDLWRILTIDGRPQIAVTLNGVDKIL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COL21A1 collagen, type XXI, alpha 1 [ Homo sapiens ]
• Official Symbol: COL21A1
• Synonyms: COL21A1; collagen, type XXI, alpha 1; collagen alpha-1(XXI) chain; alpha 1 type XXI collagen; alpha 1 chain-like collagen; FP633; COLA1L; dJ708F5.1; dJ682J15.1; FLJ39125; FLJ44623; MGC26619; DKFZp564B052
• Gene ID: 81578
• mRNA Refseq: NM_030820
• Protein Refseq: NP_110447
• MIM: 610002
• UniProt ID: Q96P44