Recombinant Human COIL Protein, GST-tagged
Cat.No. : | COIL-1633H |
Product Overview : | Human COIL full-length ORF (BAG36378.1, 1 a.a. - 576 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an integral component of Cajal bodies (also called coiled bodies). Cajal bodies are nuclear suborganelles of varying number and composition that are involved in the post-transcriptional modification of small nuclear and small nucleolar RNAs. The N-terminus of the coilin protein directs its self-oligomerization while the C-terminus influences the number of nuclear bodies assembled per cell. Differential methylation and phosphorylation of coilin likely influences its localization among nuclear bodies and the composition and assembly of Cajal bodies. This gene has pseudogenes on chromosome 4 and chromosome 14. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 89 kDa |
AA Sequence : | MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COIL coilin [ Homo sapiens ] |
Official Symbol | COIL |
Synonyms | COIL; coilin; CLN80; p80 coilin; p80; coilin p80; p80-coilin; |
Gene ID | 8161 |
mRNA Refseq | NM_004645 |
Protein Refseq | NP_004636 |
MIM | 600272 |
UniProt ID | P38432 |
◆ Recombinant Proteins | ||
COIL-958R | Recombinant Rhesus monkey COIL Protein, His-tagged | +Inquiry |
COIL-2746H | Recombinant Human COIL protein(131-240 aa), C-His-tagged | +Inquiry |
COIL-1633H | Recombinant Human COIL Protein, GST-tagged | +Inquiry |
COIL-783R | Recombinant Rhesus Macaque COIL Protein, His (Fc)-Avi-tagged | +Inquiry |
COIL-2086HF | Recombinant Full Length Human COIL Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COIL-7380HCL | Recombinant Human COIL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COIL Products
Required fields are marked with *
My Review for All COIL Products
Required fields are marked with *
0
Inquiry Basket