Recombinant Human COASY protein, T7-tagged

Cat.No. : COASY-137H
Product Overview : Recombinant human COASY (269aa, Isoform_b) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYERPELP TCLYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGIINRKVLGSRV FGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLVHEVWTAVIPETEAVRRIVERDG LSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPKTHQALD
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Protein length : 269 a.a.
Gene Name COASY CoA synthase [ Homo sapiens ]
Official Symbol COASY
Synonyms COASY; CoA synthase; Coenzyme A synthase; bifunctional coenzyme A synthase; CoASY; DPCK; NBP; PPAT; nucleotide binding protein; phosphopantetheine adenylyltransferase / dephosphocoenzyme A kinase; bifunctional phosphopantetheine adenylyl transferase/dephospho CoA kinase; UKR1; pOV-2; FLJ35179;
Gene ID 80347
mRNA Refseq NM_001042529
Protein Refseq NP_001035994
MIM 609855
UniProt ID Q13057
Chromosome Location 17q12-q21
Pathway Coenzyme A biosynthesis, organism-specific biosystem; Coenzyme A biosynthesis, pantothenate =>CoA, organism-specific biosystem; Coenzyme A biosynthesis, pantothenate => CoA, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function ATP binding; dephospho-CoA kinase activity; nucleotide binding; nucleotidyltransferase activity; pantetheine-phosphate adenylyltransferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COASY Products

Required fields are marked with *

My Review for All COASY Products

Required fields are marked with *

0

Inquiry Basket

cartIcon