Recombinant Human CNTF, StrepII-tagged

• Cat.No.: CNTF-249H
• Product Overview: Purified, full-length human recombinant CNTF or Ciliary neurotrophic factor protein (amino acids 1-200, 200 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 22.8 kDa. (Accession NP_000605.1; UniProt P26441)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 1-200, 200 a.a.
• Description: CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVH FTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >90% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: CNTF ciliary neurotrophic factor [ Homo sapiens ]
• Official Symbol: CNTF
• Synonyms: CNTF; ciliary neurotrophic factor; HCNTF
• Gene ID: 1270
• mRNA Refseq: NM_000614
• Protein Refseq: NP_000605
• MIM: 118945
• UniProt ID: P26441
• Chromosome Location: 11q12
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: ciliary neurotrophic factor receptor binding; cytokine activity; growth factor activity; interleukin-6 receptor binding