Active Recombinant Human CNTF Protein
Cat.No. : | CNTF-39H |
Product Overview : | Recombinant Human CNTF Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Ciliary neurotrophic factor (CNTF) is a neurotrophic factor that promotes the survival of neuronal cell populations, neurite outgrowth, and neurotransmitter synthesis. CNTF also plays an important protective role during nervous system injury. |
Bio-activity : | TF-1 cell proliferation, ≤325 ng/mL |
Molecular Mass : | Monomer, 22.9 kDa (200 aa) |
AA Sequence : | MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | CNTF ciliary neurotrophic factor [ Homo sapiens (human) ] |
Official Symbol | CNTF |
Synonyms | CNTF; ciliary neurotrophic factor; HCNTF; |
Gene ID | 1270 |
mRNA Refseq | NM_000614 |
Protein Refseq | NP_000605 |
MIM | 118945 |
UniProt ID | P26441 |
◆ Recombinant Proteins | ||
CNTF-2587H | Active Recombinant Human CNTF protein, His-tagged | +Inquiry |
CNTF-36H | Recombinant Human CNTF protein | +Inquiry |
CNTF-566H | Active Recombinant Human CNTF protein, His-tagged | +Inquiry |
ALDH1A3-3634H | Recombinant Human ALDH1A3 protein, GST-tagged | +Inquiry |
CNTF-058H | Recombinant Human ciliary neurotrophic factor Protein, His tagged | +Inquiry |
◆ Native Proteins | ||
CNTF-26839TH | Native Human CNTF | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTF-376HCL | Recombinant Human CNTF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNTF Products
Required fields are marked with *
My Review for All CNTF Products
Required fields are marked with *
0
Inquiry Basket