Active Recombinant Human CNTF Protein

• Cat.No.: CNTF-39H
• Product Overview: Recombinant Human CNTF Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Ciliary neurotrophic factor (CNTF) is a neurotrophic factor that promotes the survival of neuronal cell populations, neurite outgrowth, and neurotransmitter synthesis. CNTF also plays an important protective role during nervous system injury.
• Bio-activity: TF-1 cell proliferation, ≤325 ng/mL
• Molecular Mass: Monomer, 22.9 kDa (200 aa)
• AA Sequence: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: CNTF ciliary neurotrophic factor [ Homo sapiens (human) ]
• Official Symbol: CNTF
• Synonyms: CNTF; ciliary neurotrophic factor; HCNTF
• Gene ID: 1270
• mRNA Refseq: NM_000614
• Protein Refseq: NP_000605
• MIM: 118945
• UniProt ID: P26441