Recombinant Human CNTD2 Protein, GST-tagged

• Cat.No.: CNTD2-1604H
• Product Overview: Human CNTD2 full-length ORF (BAB14529.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CNTD2 (Cyclin N-Terminal Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include protein kinase binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 43.1 kDa
• AA Sequence: MLVRGRDQGSGSRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVMEYLGLAGDTLYLAVHLLDSYLSAGRVRLHRLQLLGVACLFVACKMEECVLPEETEVRNLGPFQGRE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNTD2 cyclin N-terminal domain containing 2 [ Homo sapiens ]
• Official Symbol: CNTD2
• Synonyms: CNTD2; cyclin N-terminal domain containing 2; cyclin N-terminal domain-containing protein 2; FLJ13265
• Gene ID: 79935
• mRNA Refseq: NM_024877
• Protein Refseq: NP_079153
• UniProt ID: Q9H8S5