Recombinant Full Length Human CNTD2 Protein, GST-tagged
Cat.No. : | CNTD2-1963HF |
Product Overview : | Human CNTD2 full-length ORF (BAB14529.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 155 amino acids |
Description : | CNTD2 (Cyclin N-Terminal Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include protein kinase binding. |
Molecular Mass : | 43.1 kDa |
AA Sequence : | MLVRGRDQGSGSRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVMEYLGLAGDTLYLAVHLLDSYLSAGRVRLHRLQLLGVACLFVACKMEECVLPEETEVRNLGPFQGRE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNTD2 cyclin N-terminal domain containing 2 [ Homo sapiens ] |
Official Symbol | CNTD2 |
Synonyms | CNTD2; cyclin N-terminal domain containing 2; cyclin N-terminal domain-containing protein 2; FLJ13265 |
Gene ID | 79935 |
mRNA Refseq | NM_024877 |
Protein Refseq | NP_079153 |
UniProt ID | Q9H8S5 |
◆ Recombinant Proteins | ||
CNTD2-1604H | Recombinant Human CNTD2 Protein, GST-tagged | +Inquiry |
CNTD2-1963HF | Recombinant Full Length Human CNTD2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNTD2 Products
Required fields are marked with *
My Review for All CNTD2 Products
Required fields are marked with *
0
Inquiry Basket