Recombinant Human CLUL1, His-tagged
Cat.No. : | CLUL1-70H |
Product Overview : | Recombinant Human Clusterin-Like Protein 1/CLUL1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala21-Ala442) of Human CLUL1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
ProteinLength : | 21-442 a.a. |
Description : | Clusterin-Like Protein 1 (CLUL1) is a secreted protein that belongs to the clusterin family. CLUL1 is synthesized as a 466 amino acid precursor that contains a 20 amino acid signal sequence, and a 446 amino acid mature chain. CLUL1 is expressed predominantly by cone photoreceptors of the retina. It has been shown that CLUL1 expression is down-regulated in some forms of retinal disease. |
AA Sequence : | APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQ EALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNCMRIYTTCQPSWSSVKNKIERFFRKIY QFLFPFHEDNEKDLPISEKLIEEDAQLTQMEDVFSQLTVDVNSLFNRSFNVFRQMQQEFDQTFQS HFISDTDLTEPYFFPAFSKEPMTKADLEQCWDIPNFFQLFCNFSVSIYESVSETITKMLKAIEDL PKQDKAPDHGGLISKMLPGQDRGLCGELDQNLSRCFKFHEKCQKCQAHLSEDCPDVPALHTELDE AIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAPETEIIFNSIQVVPRIHE GNISKQDETMMTDLSILPSSNFTLKIPLEESAVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | CLUL1 clusterin-like 1 (retinal) [ Homo sapiens ] |
Official Symbol | CLUL1 |
Synonyms | CLUL1; clusterin-like 1 (retinal); clusterin-like protein 1; retinal-specific clusterin-like protein; RA337M; |
Gene ID | 27098 |
mRNA Refseq | NM_014410 |
Protein Refseq | NP_055225 |
UniProt ID | Q15846 |
Chromosome Location | 18p11.32 |
◆ Native Proteins | ||
Collagen Type III-06H | Native Human Collagen Type III | +Inquiry |
CKMB-12H | Active Native Human Creatine Kinase MB protein | +Inquiry |
ECGS-32B | Native Bovine ECGS | +Inquiry |
ACPP-29981TH | Native Human ACPP | +Inquiry |
CAT-75H | Native Human Catalase | +Inquiry |
◆ Cell & Tissue Lysates | ||
AP5Z1-359HCL | Recombinant Human AP5Z1 lysate | +Inquiry |
PREX2-466HCL | Recombinant Human PREX2 cell lysate | +Inquiry |
AQP1-8770HCL | Recombinant Human AQP1 293 Cell Lysate | +Inquiry |
SEC22C-1995HCL | Recombinant Human SEC22C 293 Cell Lysate | +Inquiry |
CD27-001HCL | Recombinant Human CD27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLUL1 Products
Required fields are marked with *
My Review for All CLUL1 Products
Required fields are marked with *
0
Inquiry Basket