Recombinant Human CLIC2 Protein, GST-tagged

• Cat.No.: CLIC2-1478H
• Product Overview: Human CLIC2 full-length ORF ( AAH22305, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability. [provided by RefSeq, Jul 2017]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 52.91 kDa
• AA Sequence: MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNITKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLIC2 chloride intracellular channel 2 [ Homo sapiens ]
• Official Symbol: CLIC2
• Synonyms: CLIC2; chloride intracellular channel 2; chloride intracellular channel protein 2; XAP121; CLIC2b
• Gene ID: 1193
• mRNA Refseq: NM_001289
• Protein Refseq: NP_001280
• MIM: 300138
• UniProt ID: O15247