Recombinant Human CLEC5A Protein, 28-188aa, C-His tagged

• Cat.No.: CLEC5A-20H
• Product Overview: Recombinant human CLEC5A protein (28-188aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques was expressed in Baculovirus.

Specification

• Description: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein interacts with dnax-activation protein 12 and may play a role in cell activation. Alternative splice variants have been described but their full-length sequence has not been determined.
• Source: Baculovirus
• Species: Human
• Tag: His
• Form: Liquid
• Molecular Mass: 19.5 kDa (170aa)
• Protein length: 28-188aa
• AA Sequence: ADLPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAKHHHHHH
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Applications: SDS-PAGE
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 20 % glycerol, 1mM DTT

Gene Information

• Gene Name: CLEC5A C-type lectin domain family 5, member A [ Homo sapiens (human) ]
• Official Symbol: CLEC5A
• Synonyms: CLEC5A; C-type lectin domain family 5, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 5 , CLECSF5; C-type lectin domain family 5 member A; MDL 1; C-type lectin superfamily member 5; myeloid DAP12-associating lectin 1; myeloid DAP12-associating lectin-1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5; MDL1; MDL-1; CLECSF5; MGC138304
• Gene ID: 23601
• mRNA Refseq: NM_013252
• Protein Refseq: NP_037384
• MIM: 604987
• UniProt ID: Q9NY25