Recombinant Human CLEC5A Protein, 28-188aa, C-His tagged

Cat.No. : CLEC5A-20H
Product Overview : Recombinant human CLEC5A protein (28-188aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques was expressed in Baculovirus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 28-188aa
Description : This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein interacts with dnax-activation protein 12 and may play a role in cell activation. Alternative splice variants have been described but their full-length sequence has not been determined.
Form : Liquid
Molecular Mass : 19.5 kDa (170aa)
AA Sequence : ADLPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAKHHHHHH
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90 % by SDS-PAGE
Applications : SDS-PAGE
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 20 % glycerol, 1mM DTT
Gene Name CLEC5A C-type lectin domain family 5, member A [ Homo sapiens (human) ]
Official Symbol CLEC5A
Synonyms CLEC5A; C-type lectin domain family 5, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 5 , CLECSF5; C-type lectin domain family 5 member A; MDL 1; C-type lectin superfamily member 5; myeloid DAP12-associating lectin 1; myeloid DAP12-associating lectin-1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5; MDL1; MDL-1; CLECSF5; MGC138304
Gene ID 23601
mRNA Refseq NM_013252
Protein Refseq NP_037384
MIM 604987
UniProt ID Q9NY25

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLEC5A Products

Required fields are marked with *

My Review for All CLEC5A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon