Recombinant Human CLDN7 Protein, GST-tagged

• Cat.No.: CLDN7-1446H
• Product Overview: Human CLDN7 full-length ORF ( NP_001298.2, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, May 2010]
• Molecular Mass: 48.8 kDa
• AA Sequence: MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLDN7 claudin 7 [ Homo sapiens ]
• Official Symbol: CLDN7
• Synonyms: CLDN7; claudin 7; CEPTRL2, CPETRL2; claudin-7; Hs.84359; clostridium perfringens enterotoxin receptor-like 2; CLDN-7; CEPTRL2; CPETRL2; claudin-1
• Gene ID: 1366
• mRNA Refseq: NM_001185022
• Protein Refseq: NP_001171951
• MIM: 609131
• UniProt ID: O95471