Recombinant Human CLDN5 protein, GST-tagged

Cat.No. : CLDN5-16H
Product Overview : Recombinant Human CLDN5(29 a.a. - 81 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 29-81 a.a.
Description : This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 31.57 kDa
AA Sequence : MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CLDN5 claudin 5 [ Homo sapiens ]
Official Symbol CLDN5
Synonyms CLDN5; claudin 5; AWAL, TMVCF, transmembrane protein deleted in velocardiofacial syndrome; claudin-5; BEC1; CPETRL1; TMDVCF; transmembrane protein deleted in VCFS; transmembrane protein deleted in velocardiofacial syndrome; AWAL; TMVCF;
Gene ID 7122
mRNA Refseq NM_003277
Protein Refseq NP_003268
MIM 602101
UniProt ID O00501
Chromosome Location 22q11.21
Pathway Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Hepatitis C, organism-specific biosystem;
Function identical protein binding; structural molecule activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLDN5 Products

Required fields are marked with *

My Review for All CLDN5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon