Recombinant Human CLDN3 protein, His-B2M-tagged

Cat.No. : CLDN3-2700H
Product Overview : Recombinant Human CLDN3 protein(O15551)(30-80aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : B2M&His
Protein Length : 30-80aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 19.7 kDa
AA Sequence : RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CLDN3 claudin 3 [ Homo sapiens ]
Official Symbol CLDN3
Synonyms CLDN3; claudin 3; C7orf1, CPETR2; claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE R2; CPE receptor 2; HRVP1; RVP1; ventral prostate.1 like protein; CPE-R 2; CPE-receptor 2; ventral prostate.1-like protein; ventral prostate.1 protein homolog; C7orf1; CPE-R2; CPETR2;
Gene ID 1365
mRNA Refseq NM_001306
Protein Refseq NP_001297
MIM 602910
UniProt ID O15551

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLDN3 Products

Required fields are marked with *

My Review for All CLDN3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon