Recombinant Human CLDN3 protein, His-B2M-tagged

• Cat.No.: CLDN3-2700H
• Product Overview: Recombinant Human CLDN3 protein(O15551)(30-80aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&B2M
• ProteinLength: 30-80aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.7 kDa
• AA Sequence: RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CLDN3 claudin 3 [ Homo sapiens ]
• Official Symbol: CLDN3
• Synonyms: CLDN3; claudin 3; C7orf1, CPETR2; claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE R2; CPE receptor 2; HRVP1; RVP1; ventral prostate.1 like protein; CPE-R 2; CPE-receptor 2; ventral prostate.1-like protein; ventral prostate.1 protein homolog; C7orf1; CPE-R2; CPETR2
• Gene ID: 1365
• mRNA Refseq: NM_001306
• Protein Refseq: NP_001297
• MIM: 602910
• UniProt ID: O15551