Recombinant Human CLCA2 Protein, GST-tagged

• Cat.No.: CLCA2-1409H
• Product Overview: Human CLCA2 partial ORF ( NP_006527, 300 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the calcium-activated chloride channel regulator (CLCR) family of proteins. Members of this family regulate the transport of chloride across the plasma membrane. The encoded protein is autoproteolytically processed to generate N- and C- terminal fragments. Expression of this gene is upregulated by the tumor suppressor protein p53 in response to DNA damage. In breast cancer, expression of this gene is downregulated and the encoded protein may inhibit migration and invasion while promoting mesenchymal-to-epithelial transition in cancer cell lines. [provided by RefSeq, Sep 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.85 kDa
• AA Sequence: PTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVGIASFDSKGEIRAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLCA2 chloride channel accessory 2 [ Homo sapiens ]
• Official Symbol: CLCA2
• Synonyms: CLCA2; chloride channel accessory 2; chloride channel regulator 2 , chloride channel, calcium activated, family member 2; calcium-activated chloride channel regulator 2; CLCRG2; hCLCA2; hCaCC-3; chloride channel regulator 2; calcium-activated chloride channel-2; calcium-activated chloride channel protein 3; CLCA family member 2, chloride channel regulator; calcium-activated chloride channel family member 2; chloride channel, calcium activated, family member 2; CACC; CACC3; CaCC-3; FLJ97885
• Gene ID: 9635
• mRNA Refseq: NM_006536
• Protein Refseq: NP_006527
• MIM: 604003
• UniProt ID: Q9UQC9