Recombinant Human CLC Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CLC-4142H |
Product Overview : | CLC MS Standard C13 and N15-labeled recombinant protein (NP_001819) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. |
Molecular Mass : | 16.3 kDa |
AA Sequence : | MSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CLC Charcot-Leyden crystal protein [ Homo sapiens (human) ] |
Official Symbol | CLC |
Synonyms | CLC; Charcot-Leyden crystal protein; eosinophil lysophospholipase; galectin 10; LGALS10; LPPL_HUMAN; lysolecithin acylhydrolase; MGC149659; galectin-10; GAL10; Gal-10; LGALS10A; |
Gene ID | 1178 |
mRNA Refseq | NM_001828 |
Protein Refseq | NP_001819 |
MIM | 153310 |
UniProt ID | Q05315 |
◆ Recombinant Proteins | ||
CLC-28114TH | Recombinant Human CLC, His-tagged | +Inquiry |
CLC-1408H | Recombinant Human CLC Protein, GST-tagged | +Inquiry |
CLC-4142H | Recombinant Human CLC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLC-11272H | Recombinant Human CLC, GST-tagged | +Inquiry |
CLC-984H | Recombinant Human Charcot-Leyden Crystal Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLC-7479HCL | Recombinant Human CLC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLC Products
Required fields are marked with *
My Review for All CLC Products
Required fields are marked with *
0
Inquiry Basket