Recombinant Human CLC Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CLC-4142H
• Product Overview: CLC MS Standard C13 and N15-labeled recombinant protein (NP_001819) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 16.3 kDa
• AA Sequence: MSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CLC Charcot-Leyden crystal protein [ Homo sapiens (human) ]
• Official Symbol: CLC
• Synonyms: CLC; Charcot-Leyden crystal protein; eosinophil lysophospholipase; galectin 10; LGALS10; LPPL_HUMAN; lysolecithin acylhydrolase; MGC149659; galectin-10; GAL10; Gal-10; LGALS10A
• Gene ID: 1178
• mRNA Refseq: NM_001828
• Protein Refseq: NP_001819
• MIM: 153310
• UniProt ID: Q05315