Recombinant Human CLC Protein, GST-tagged

• Cat.No.: CLC-1408H
• Product Overview: Human CLC partial ORF ( NP_001819.2, 52 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. [provided by RefSeq, Jul 2008]
• Molecular Mass: 35.75 kDa
• AA Sequence: FHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLC Charcot-Leyden crystal protein [ Homo sapiens ]
• Official Symbol: CLC
• Synonyms: CLC; Charcot-Leyden crystal protein; eosinophil lysophospholipase; galectin 10; LGALS10; LPPL_HUMAN; lysolecithin acylhydrolase; MGC149659; galectin-10; GAL10; Gal-10; LGALS10A
• Gene ID: 1178
• mRNA Refseq: NM_001828
• Protein Refseq: NP_001819
• MIM: 153310
• UniProt ID: Q05315