Recombinant Human CKM protein(21-120 aa), C-His-tagged

• Cat.No.: CKM-2571H
• Product Overview: Recombinant Human CKM protein(P06732)(21-120 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 21-120 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 14 kDa
• AASequence: PDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDD
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CKM creatine kinase, muscle [ Homo sapiens ]
• Official Symbol: CKM
• Synonyms: CKM; creatine kinase, muscle; CKMM; creatine kinase M-type; creatine kinase-M; creatine kinase M chain; M-CK
• Gene ID: 1158
• mRNA Refseq: NM_001824
• Protein Refseq: NP_001815
• MIM: 123310
• UniProt ID: P06732