Recombinant Human CIRBP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CIRBP-4248H
• Product Overview: CIRBP MS Standard C13 and N15-labeled recombinant protein (NP_001271) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CIRBP (Cold Inducible RNA Binding Protein) is a Protein Coding gene. Diseases associated with CIRBP include Cryptorchidism, Unilateral Or Bilateral. Among its related pathways are Neuroscience and Translational Control. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and nucleotide binding. An important paralog of this gene is RBMX.
• Molecular Mass: 18.6 kDa
• AA Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CIRBP cold inducible RNA binding protein [ Homo sapiens (human) ]
• Official Symbol: CIRBP
• Synonyms: CIRBP; cold inducible RNA binding protein; cold-inducible RNA-binding protein; CIRP; Cold inducible RNA binding protein; glycine rich RNA binding protein; A18 hnRNP; glycine-rich RNA binding protein; cold inducible RNA-binding protein; glycine-rich RNA-binding protein CIRP
• Gene ID: 1153
• mRNA Refseq: NM_001280
• Protein Refseq: NP_001271
• MIM: 602649
• UniProt ID: Q14011