Recombinant Human CIRBP protein, GST-tagged

• Cat.No.: CIRBP-4368H
• Product Overview: Recombinant Human CIRBP protein(Q14011)(1-172aa), fused to N-terminal GST tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-172aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 45.6 kDa
• AA Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CIRBP cold inducible RNA binding protein [ Homo sapiens ]
• Official Symbol: CIRBP
• Synonyms: CIRBP; cold inducible RNA binding protein; cold-inducible RNA-binding protein; CIRP; Cold inducible RNA binding protein; glycine rich RNA binding protein; A18 hnRNP; glycine-rich RNA binding protein; cold inducible RNA-binding protein; glycine-rich RNA-binding protein CIRP
• Gene ID: 1153
• mRNA Refseq: NM_001280
• Protein Refseq: NP_001271
• MIM: 602649
• UniProt ID: Q14011