Recombinant Human CIRBP protein, GST-tagged

Cat.No. : CIRBP-4368H
Product Overview : Recombinant Human CIRBP protein(Q14011)(1-172aa), fused to N-terminal GST tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-172aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 45.6 kDa
AA Sequence : MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CIRBP cold inducible RNA binding protein [ Homo sapiens ]
Official Symbol CIRBP
Synonyms CIRBP; cold inducible RNA binding protein; cold-inducible RNA-binding protein; CIRP; Cold inducible RNA binding protein; glycine rich RNA binding protein; A18 hnRNP; glycine-rich RNA binding protein; cold inducible RNA-binding protein; glycine-rich RNA-binding protein CIRP;
Gene ID 1153
mRNA Refseq NM_001280
Protein Refseq NP_001271
MIM 602649
UniProt ID Q14011

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CIRBP Products

Required fields are marked with *

My Review for All CIRBP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon