Recombinant Human CIITA Protein, GST-tagged

• Cat.No.: CIITA-5313H
• Product Overview: Human MHC2TA partial ORF ( NP_000237, 39 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein with an acidic transcriptional activation domain, 4 LRRs (leucine-rich repeats) and a GTP binding domain. The protein is located in the nucleus and acts as a positive regulator of class II major histocompatibility complex gene transcription, and is referred to as the "master control factor" for the expression of these genes. The protein also binds GTP and uses GTP binding to facilitate its own transport into the nucleus. Once in the nucleus it does not bind DNA but rather uses an intrinsic acetyltransferase (AT) activity to act in a coactivator-like fashion. Mutations in this gene have been associated with bare lymphocyte syndrome type II (also known as hereditary MHC class II deficiency or HLA class II-deficient combined immunodeficiency), increased susceptibility to rheumatoid arthritis, multiple sclerosis, and possibly myocardial infarction. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: NSDADPLCLYHFYDQMDLAGEEEIELYSEPDTDTINCDQFSRLLCDMEGDEETREAYANIAELDQYVFQDSQLEGLSKDIFKHIGPDEVIGESMEMPAEVGQKSQKRPFP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CIITA class II, major histocompatibility complex, transactivator [ Homo sapiens ]
• Official Symbol: CIITA
• Synonyms: CIITA; class II, major histocompatibility complex, transactivator; MHC class II transactivator , MHC2TA; MHC class II transactivator; C2TA; NLR family; acid domain containing; NLRA; nucleotide binding oligomerization domain; leucine rich repeat and acid domain containing; NLR family, acid domain containing; MHC class II transactivator type III; nucleotide-binding oligomerization domain, leucine rich repeat and acid domain containing; MHC2TA; CIITAIV
• Gene ID: 4261
• mRNA Refseq: NM_000246
• Protein Refseq: NP_000237
• MIM: 600005
• UniProt ID: P33076