Recombinant Human CHSY1 Protein, GST-tagged

• Cat.No.: CHSY1-1348H
• Product Overview: Human CHSY1 partial ORF ( NP_055733.2, 516 a.a. - 624 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the chondroitin N-acetylgalactosaminyltransferase family. These enzymes possess dual glucuronyltransferase and galactosaminyltransferase activity and play critical roles in the biosynthesis of chondroitin sulfate, a glycosaminoglycan involved in many biological processes including cell proliferation and morphogenesis. Decreased expression of this gene may play a role in colorectal cancer, and mutations in this gene are a cause of temtamy preaxial brachydactyly syndrome. [provided by RefSeq, Dec 2011]
• Molecular Mass: 37.73 kDa
• AA Sequence: PFQLPGSKSEHKEPKDKKINILIPLSGRFDMFVRFMGNFEKTCLIPNQNVKLVVLLFNSDSNPDKAKQVELMRDYRIKYPKADMQILPVSGEFSRALALEVGSSQFNNE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHSY1 chondroitin sulfate synthase 1 [ Homo sapiens ]
• Official Symbol: CHSY1
• Synonyms: CHSY1; chondroitin sulfate synthase 1; carbohydrate (chondroitin) synthase 1; CSS1; KIAA0990; chondroitin synthase 1; carbohydrate synthase 1; chondroitin glucuronyltransferase 1; N-acetylgalactosaminyltransferase II; chondroitin glucuronyltransferase II; N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 1; glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase 1; CHSY; TPBS; ChSy-1; FLJ58581; DKFZp434M032
• Gene ID: 22856
• mRNA Refseq: NM_014918
• Protein Refseq: NP_055733
• MIM: 608183
• UniProt ID: Q86X52