Recombinant Human CHST13 Protein, GST-tagged

Description :	The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to the C4 hydroxyl of beta-1,4-linked N-acetylgalactosamine (GalNAc) flanked by glucuronic acid residue in chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. [provided by RefSeq, Aug 2011]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	51.9 kDa
AA Sequence :	MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWKRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERLASAYRNKLARTRSATRVASATTSWASSRRWRRTRPSCWAWRAHPT
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CHST13 carbohydrate (chondroitin 4) sulfotransferase 13 [ Homo sapiens ]
Official Symbol	CHST13
Synonyms	CHST13; carbohydrate (chondroitin 4) sulfotransferase 13; carbohydrate sulfotransferase 13; C4ST3; C4ST-3; chondroitin 4-sulfotransferase 3; chondroitin 4-O-sulfotransferase 3; MGC119278; MGC119279; MGC119281;
Gene ID	166012
mRNA Refseq	NM_152889
Protein Refseq	NP_690849
MIM	610124
UniProt ID	Q8NET6