Recombinant Full Length Human CHST13 Protein, GST-tagged
Cat.No. : | CHST13-1830HF |
Product Overview : | Human CHST13 full-length ORF ( AAI03897.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to the C4 hydroxyl of beta-1,4-linked N-acetylgalactosamine (GalNAc) flanked by glucuronic acid residue in chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. [provided by RefSeq, Aug 2011] |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 51.9 kDa |
Protein length : | 225 amino acids |
AA Sequence : | MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWKRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERLASAYRNKLARTRSATRVASATTSWASSRRWRRTRPSCWAWRAHPT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHST13 carbohydrate (chondroitin 4) sulfotransferase 13 [ Homo sapiens ] |
Official Symbol | CHST13 |
Synonyms | CHST13; carbohydrate (chondroitin 4) sulfotransferase 13; carbohydrate sulfotransferase 13; C4ST3; C4ST-3; chondroitin 4-sulfotransferase 3; chondroitin 4-O-sulfotransferase 3; MGC119278; MGC119279; MGC119281 |
Gene ID | 166012 |
mRNA Refseq | NM_152889 |
Protein Refseq | NP_690849 |
MIM | 610124 |
UniProt ID | Q8NET6 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHST13 Products
Required fields are marked with *
My Review for All CHST13 Products
Required fields are marked with *
0
Inquiry Basket