Recombinant Full Length Human CHST13 Protein, GST-tagged

Cat.No. : CHST13-1830HF
Product Overview : Human CHST13 full-length ORF ( AAI03897.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to the C4 hydroxyl of beta-1,4-linked N-acetylgalactosamine (GalNAc) flanked by glucuronic acid residue in chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. [provided by RefSeq, Aug 2011]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 51.9 kDa
Protein length : 225 amino acids
AA Sequence : MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWKRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERLASAYRNKLARTRSATRVASATTSWASSRRWRRTRPSCWAWRAHPT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHST13 carbohydrate (chondroitin 4) sulfotransferase 13 [ Homo sapiens ]
Official Symbol CHST13
Synonyms CHST13; carbohydrate (chondroitin 4) sulfotransferase 13; carbohydrate sulfotransferase 13; C4ST3; C4ST-3; chondroitin 4-sulfotransferase 3; chondroitin 4-O-sulfotransferase 3; MGC119278; MGC119279; MGC119281
Gene ID 166012
mRNA Refseq NM_152889
Protein Refseq NP_690849
MIM 610124
UniProt ID Q8NET6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CHST13 Products

Required fields are marked with *

My Review for All CHST13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon