Recombinant Human CHST1 Protein, GST-Tagged

• Cat.No.: CHST1-1294H
• Product Overview: Human CHST1 partial ORF (NP_003645, 168 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This locus encodes a member of the keratin sulfotransferase family of proteins. The encoded enzyme catalyzes the sulfation of the proteoglycan keratin. [provided by RefSeq, Aug 2011]
• Molecular Mass: 36.74 kDa
• AA Sequence: PPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHST1 carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 [ Homo sapiens ]
• Official Symbol: CHST1
• Synonyms: CHST1; carbohydrate (keratan sulfate Gal-6) sulfotransferase 1; carbohydrate sulfotransferase 1; C6ST; KSGal6ST; carbohydrate (chondroitin 6/keratan) sulfotransferase 1; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1; KSST; GST-1; KS6ST
• Gene ID: 8534
• mRNA Refseq: NM_003654
• Protein Refseq: NP_003645
• MIM: 603797
• UniProt ID: O43916