Recombinant Human Chromodomain Helicase DNA Binding Protein 7, His-tagged

• Cat.No.: CHD7-4914H
• Product Overview: Recombinant full length human CHD7 containing N-terminal His tag was expressed by E. coli.

Specification

• Cat. No.: CHD7-4914H
• Description: CHD7 is a N-terminal His-tagged recombinant protein and a member of the Sso7d family of small, abundant, non-specific DNA-binding proteins from the hyperthermophilic Archea Sulfolobus. The 7-kDa protein from Sulfolobus spp. consists of a five stranded, incomplete β-barrel capped at the opening by a C-terminal α-helix; they bind to the minor groove of a DNA duplex via the triple-stranded β-sheet.
• Molecular Weight: 9.44 kDa
• Source: E. coli
• Species: Human
• Form: Sterile filtered and lyophilized with no additives.
• Appearance: Lyophilized protein
• Sequence: MGSSHHHHHHSSGLVPRGSHMATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
• Endotoxin Level: <0.1 ng/μg
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in ddH2O to a concentration of 1.0 mg/ml. Aliquot and store at -20°C for future use. Repeated freeze/thaw cycles should be avoided.
• Purity: >99% by SDS-PAGE
• Storage: The lyophilized CHD7 is best-stored desiccated below 0°C. Reconstituted protein should be stored in working aliquots at -20°C.
• Pathways: Noncanonical Wnt signaling pathway
• Full Length: Full L.

Gene Information

• Gene Name: CHD7 chromodomain helicase DNA binding protein 7 [ Homo sapiens ]
• Official Symbol: CHD7
• Synonyms: CHD7; chromodomain helicase DNA binding protein 7; IS3; KAL5; FLJ20357; FLJ20361; KIAA1416; chromodomain-helicase-DNA-binding protein 7; OTTHUMP00000229376; ATP-dependent helicase CHD7; chromodomain helicase DNA binding protein 7 isoform CRA_e; EC 3.6.4.12
• Gene ID: 55636
• mRNA Refseq: NM_017780
• Protein Refseq: NP_060250
• MIM: 608892
• UniProt ID: Q9P2D1
• Chromosome Location: 8q12.2
• Function: ATP binding; DNA binding; chromatin binding; helicase activity; hydrolase activity, acting on acid anhydrides; nucleotide binding