Recombinant Human CHD7 Protein

• Cat.No.: CHD7-1216H
• Product Overview: Human CHD7 (P39476, 64 amino acids) partial recombinant protein with His tag expressed in Escherichia coli.

Specification

• Description: This gene encodes a protein that contains several helicase family domains. Mutations in this gene have been found in some patients with the CHARGE syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]
• Source: E. coli
• Species: Human
• Form: Lyophlized
• Molecular Mass: 9.44 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
• Endotoxin: < 0.1 EU/μg
• Purity: >= 99% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: No additive
• Tag: Non

Gene Information

• Gene Name: CHD7 chromodomain helicase DNA binding protein 7 [ Homo sapiens ]
• Official Symbol: CHD7
• Synonyms: CHD7; chromodomain helicase DNA binding protein 7; FLJ20357; FLJ20361; KIAA1416
• Gene ID: 55636
• mRNA Refseq: NM_017780
• Protein Refseq: NP_060250
• MIM: 608892
• UniProt ID: Q9P2D1