Recombinant Human CHRNE

• Cat.No.: CHRNE-29131TH
• Product Overview: Recombinant fragment Human Nicotinic Acetylcholine Receptor epsilon with N-terminal proprietary tag.Mol Wt 37.73 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: Acetylcholine receptors at mature mammalian neuromuscular junctions are pentameric protein complexes composed of four subunits in the ratio of two alpha subunits to one beta, one epsilon, and one delta subunit. The acetylcholine receptor changes subunit composition shortly after birth when the epsilon subunit replaces the gamma subunit seen in embryonic receptors. Mutations in the epsilon subunit are associated with congenital myasthenic syndrome.
• Molecular Weight: 37.730kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNL ISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRV PSELVWLPEIVLENNIDGQFGVAYDANVLV
• Sequence Similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Epsilon/CHRNE sub-subfamily.

Gene Information

• Gene Name: CHRNE cholinergic receptor, nicotinic, epsilon [ Homo sapiens ]
• Official Symbol: CHRNE
• Synonyms: CHRNE; cholinergic receptor, nicotinic, epsilon; cholinergic receptor, nicotinic, epsilon polypeptide; acetylcholine receptor subunit epsilon; ACHRE
• Gene ID: 1145
• mRNA Refseq: NM_000080
• Protein Refseq: NP_000071
• MIM: 100725
• Uniprot ID: Q04844
• Chromosome Location: 17p13.2
• Pathway: Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; ErbB2/ErbB3 signaling events, organism-specific biosystem; Highly sodium permeable acetylcholine nicotinic receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem
• Function: acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; cation transmembrane transporter activity; extracellular ligand-gated ion channel activity; ion channel activity