Recombinant Human CHRNE protein, His&Myc-tagged

• Cat.No.: CHRNE-5776H
• Product Overview: Recombinant Human CHRNE protein(Q04844)(21-239aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 21-239aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.5 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRK

Gene Information

• Gene Name: CHRNE cholinergic receptor, nicotinic, epsilon (muscle) [ Homo sapiens ]
• Official Symbol: CHRNE
• Synonyms: CHRNE; cholinergic receptor, nicotinic, epsilon (muscle); cholinergic receptor, nicotinic, epsilon; acetylcholine receptor subunit epsilon; acetylcholine receptor; nicotinic; epsilon (muscle); ACHRE; AchR epsilon subunit; acetylcholine receptor, nicotinic, epsilon (muscle); cholinergic receptor, nicotinic, epsilon polypeptide; CMS1D; CMS1E; CMS2A; FCCMS; SCCMS
• Gene ID: 1145
• mRNA Refseq: NM_000080
• Protein Refseq: NP_000071
• MIM: 100725
• UniProt ID: Q04844